PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01490g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 725aa    MW: 79038.2 Da    PI: 6.6215
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01490g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-095105471954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Niben101Scf01490g00001.1 510 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 547
                               554459******************************88 PP

2BELL93.22.5e-303884421872
                      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +Vd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  Niben101Scf01490g00001.1 388 KVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTALAQKAMSRHFRCLKDAITAQL 442
                               7***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-62306440IPR006563POX domain
PfamPF075268.4E-41311439IPR006563POX domain
PROSITE profilePS5007112.6488551IPR001356Homeobox domain
CDDcd000862.59E-12491552No hitNo description
SMARTSM003891.0E-9491555IPR001356Homeobox domain
SuperFamilySSF466895.13E-17493558IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28494557IPR009057Homeodomain-like
PfamPF059203.6E-18508547IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MSQDYHHQSL FSFPNGFERS QAEQQQQQQQ QHMAQQIRRD KLRVQGFEPQ QFEEEASGLP  60
VYDQTAGMLS EMFSFPPGTS STELLESQFN PNFRHPNPNQ RSQPQQIPPP AGMENAWFGN  120
RQGMVVPLGY AKNHNNQISS AGINAAESMQ LFLMNPQPRS PSPSPSHPPP PPPSTNSSTL  180
HMLLPNPSST STLEGFPNPA EGSFGQFTWG NNGGASATLN TPNEIGAGVN HVVESQGLSL  240
SLSSSLQHKA EELRMGEESG MLFFNQGGGG STTSGQFRYK NLNIGNSGIV GQNLHQQVHA  300
GYGSSLGVVN VLRNSRYAKA AEELLEEFCS VGRGKFKKNN KATAVNPYSN NPSGGANGGG  360
GNNNTSSSSS KDLPPLSAAD RIEHQRRKVD RRYNHYCEQM QMVVNSFDLV MGFGAAIPYT  420
ALAQKAMSRH FRCLKDAITA QLKHSCELLG DKDAGTSGLT KGETPRLKML EQSLRQQRAF  480
HQMGMMEQEA WRPQRGLPER SVNVLRAWLF EHFLHPYPSD ADKHLLARQT GLSRNQVSNW  540
FINARVRLWK PMVEEMYQQE AKEEEDEDDE RENSQNQNSG NNAQTPTPNM SNSSSTNMTT  600
TTTALGAAAA AAETGTAATA TTATAASTLG KRSEINAPEN DPSLVAINSH ISFSENQATF  660
PTNIHDSDVA ACRRGGNFAG DDYGTTTNSD VGSTMIRFGT TAGDVSLTLG LRHAGNLPEN  720
THFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16497555563Homeobox protein Meis2
3k2a_B2e-16497555563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776283.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW801e-162BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLM1AMS50.0M1AMS5_SOLTU; Uncharacterized protein
STRINGSolyc02g089940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-138BEL1-like homeodomain 2